PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10020171m
Common NameCICLE_v10020171mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 442aa    MW: 49001.3 Da    PI: 8.4814
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10020171mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-3346100155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Ciclev10020171m  46 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 100
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.01443103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-3144101IPR009057Homeodomain-like
SuperFamilySSF466899.14E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-2346101IPR006447Myb domain, plants
PfamPF002495.3E-104899IPR001005SANT/Myb domain
PfamPF143791.5E-23187233IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MYHHHQNQGK SMHSSSRMPI PTERHLFLQG GSGPGDSGLV LSTDAKPRLK WTPDLHERFI  60
EAVNQLGGAD KATPKTVMKL MGIPGLTLYH LKSHLQKYRL SKNLHGQANI GNNKIGKKTI  120
SQKSANYQKD QNCNTYLACK AHTGIGGMKF KSSGVGPVTV PGERMPEANA THMNNLSIGP  180
QPNKSLHISE TIQMQIEVQR RLHEQLEVQR HLQLRIEAQG KYLQAVLEKA QETLGRQNLG  240
TAGLEAAKVQ LSELVSKVST QCLNSTFSDL KELQGFCPQQ PQANQPTDCS MDSCLTSCEG  300
SQKDQEIHNG GVRLRPYHGT PTLEPKEIVE EPMLQQTELK WRKDLKESKF LSSIGKDRGP  360
GELSIGSGSF PAGRFKASNE DEHFQDQTNK KPEGAKLENE NLLPEYRLPC FSTKLDLNAH  420
DHENDVASGC KQFDLNGFSW N*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006443379.10.0hypothetical protein CICLE_v10020171mg
TrEMBLV4VTW00.0V4VTW0_9R
TrEMBLA0A067EVY10.0A0A067EVY1_CITSI; Uncharacterized protein
STRINGPOPTR_0013s05670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33362764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-157G2-like family protein